PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00273.1_g00024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 836aa    MW: 94775.4 Da    PI: 7.39
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00273.1_g00024.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.48.1e-14853248
                             SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  Rsa1.0_00273.1_g00024.1  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                             78*****************************.************986 PP

2Myb_DNA-binding34.45e-1160103248
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                WT eEde+l+++ k+l++  W+tIa  +g  Rt+ qc +r+ k+l
  Rsa1.0_00273.1_g00024.1  60 TEWTREEDEKLLHLAKLLPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                              68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
CDDcd001671.49E-111053No hitNo description
PfamPF139214.0E-131070No hitNo description
SuperFamilySSF466898.27E-2133109IPR009057Homeodomain-like
CDDcd116593.79E-3055106No hitNo description
Gene3DG3DSA:1.10.10.605.6E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.67558107IPR017930Myb domain
SMARTSM007172.3E-1258105IPR001005SANT/Myb domain
PfamPF118311.0E-52407659IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 836 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLLPTQ WRTIAPIVGR TPSQCLERYE KLLDAACTKD ENYEASDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIGGRHK NRKRKGIDYN AEIPFEKRAP AGFYDTGDED RPADQVKFPT  240
TIEELEGKRR ADVEAQLRRQ DVARNKINER KDAPAAILQA NKLNDPEAVR KRSKLMLPPP  300
QISDHELEEI AKMGYASDLL TENEELTEGS AATRALLANY SQTPKQGITP VRTPQRTPAG  360
KGDAIMMEAE NLARLRDSQT PLLGGENPEL HPSDFTGVTP RKKEIQTPNL MLTPSMTPSM  420
TPGGAGLTPR IGLTPSRDGS SFAMTPRGTP FRDELHINED MDMHDSAKLE RQRREEARRS  480
LRSGLTGLPQ PRNEYHIVAQ PPPEEIEEPE EKIEEDMSDK IAREKAEKEA RHQALLRKRS  540
KVLQRDLPRP PAASLELIRN SLLSANGDKS SVVPPTPEEV ADELVRKELL QLLEHDNAKY  600
PLDEKTEKKK GVKNRANSSG SQVTAIEDFE ETELEEADKM VKEEAQFLCV AMGNENKTLD  660
DFVKAHDDCV KDVMYFPTRN AYGPSSVAVK AEKVAALQVE MENARKKMEE DEKKAEHMKA  720
KYRTYTKGHE KRAETVWSQI EASLKQIEIG GTEVECFKAL KRQEEMAASF RKKNLEEEVV  780
KQKETERKLQ ARYGELLSTL EKAEEIMVGF RAQALKQADA EDSSHNLKEA KLATGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10132242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIGGRHKNRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893310.0AC189331.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB037O12, complete sequence.
GenBankAC1895190.0AC189519.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB091G04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110802.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLM4EPS70.0M4EPS7_BRARP; Uncharacterized protein
STRINGBra030798.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64532742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5